SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011243805.1.95485 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011243805.1.95485
Domain Number 1 Region: 90-157
Classification Level Classification E-value
Superfamily PRC-barrel domain 0.00000068
Family MTH1895 0.037
Further Details:      
 
Weak hits

Sequence:  WP_011243805.1.95485
Domain Number - Region: 10-76
Classification Level Classification E-value
Superfamily PRC-barrel domain 0.00416
Family MTH1895 0.047
Further Details:      
 
Domain Number - Region: 183-226
Classification Level Classification E-value
Superfamily Apolipoprotein 0.0575
Family Apolipoprotein 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011243805.1.95485
Sequence length 290
Comment MULTISPECIES: hypothetical protein [Synechococcus]; AA=GCF_000012525.1; RF=na; TAX=1140; STAX=32046; NAME=Synechococcus elongatus PCC 7942; strain=PCC 7942; AL=Complete Genome; RT=Major
Sequence
MAMSDQPEELRVSDLLNRQVLDRQTTDEHGRIDRVWMHPPAHRVLGFLCKQGLIRGEFSA
FRLDQLHALGDDSVVLEAAPQPANPEKVDRLESLLQHEVWTDAGLHVGKIVDCRFDRQTG
YISAYLVSPHGWRGVAGMLWDLDPQLVLSYGQARVLVAELDPETLPVYEAGLTEAVAGSE
PDYRHLLGDLRQRARHWKQELKLQVSKVKEQAQEVLAQVQEVREQVQQPLDWEDATPQPL
TAIAEDEEDWDAAETALQPLPELRPKSAAIAPPAQPLIPPEAWDDDDPWV
Download sequence
Identical sequences A0A0H3K3Q0 Q31SD5
WP_011243805.1.45845 WP_011243805.1.5740 WP_011243805.1.95485 gi|81298813|ref|YP_399021.1| 1140.Synpcc7942_0002 269084.syc1495_c gi|56751504|ref|YP_172205.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]