SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011290569.1.72373 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011290569.1.72373
Domain Number 1 Region: 3-110
Classification Level Classification E-value
Superfamily SpoIIaa-like 4.91e-31
Family Anti-sigma factor antagonist SpoIIaa 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011290569.1.72373
Sequence length 117
Comment anti-sigma B factor antagonist [Thermobifida fusca]; AA=GCF_000401915.1; RF=na; TAX=1169414; STAX=2021; NAME=Thermobifida fusca TM51; strain=TM51; AL=Contig; RT=Major
Sequence
MDLKLDHHTQDDTEVVVVEGEIDVYTAPRLRELLIDLVNKGHHHLIVNMEKVEFLDSTGL
GVLVGGLKRVRAHDGTLDLVCTQERILKIFRITGLTKVFGIYESVQEAIDKRKSKQS
Download sequence
Identical sequences Q47TQ4
269800.Tfu_0122 WP_011290569.1.72373 WP_011290569.1.82272 gi|72160526|ref|YP_288183.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]