SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011305491.1.22081 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011305491.1.22081
Domain Number 1 Region: 3-49
Classification Level Classification E-value
Superfamily Ribosomal protein L39e 8.24e-18
Family Ribosomal protein L39e 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011305491.1.22081
Sequence length 51
Comment MULTISPECIES: 50S ribosomal protein L39 [Methanosarcina]; AA=GCF_000970025.1; RF=representative genome; TAX=1434108; STAX=2208; NAME=Methanosarcina barkeri MS; strain=MS; AL=Complete Genome; RT=Major
Sequence
MSHNMKGQKIRLAKAHKQNTRVPVWVIVKTNRKVVSHPRRRHWRRRSLDVK
Download sequence
Identical sequences A0A0G3CE36 Q46FA3
WP_011305491.1.13151 WP_011305491.1.22081 WP_011305491.1.33551 WP_011305491.1.36239 WP_011305491.1.38397 WP_011305491.1.42324 WP_011305491.1.64521 WP_011305491.1.74748 gi|73668004|ref|YP_304019.1| 269797.Mbar_A0457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]