SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011347100.1.79359 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011347100.1.79359
Domain Number 1 Region: 142-427
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 6.8e-127
Family Enolase 0.0000000253
Further Details:      
 
Domain Number 2 Region: 4-136
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.04e-53
Family Enolase N-terminal domain-like 0.00000579
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011347100.1.79359
Sequence length 430
Comment MULTISPECIES: enolase [Xanthomonas]; AA=GCF_001009175.1; RF=na; TAX=456327; STAX=456327; NAME=Xanthomonas euvesicatoria; strain=H3-2; AL=Scaffold; RT=Major
Sequence
MTTIAKILAREILDSRGNPTLEAEVTLDDGSFGRAAVPSGASTGTKEAVELRDGDKTRYL
GKGVRHAVDNVNGTIAETLKNFDAADQQGLDRRLIDLDGTENKGRLGANALLGVSLAAAH
AVAASRKQPLWQYLSTITESDVALPVPMMNIINGGAHADNNVDFQEFMVLPVGCSSFSEA
LRAGTEIFHSLKSVLKGHGLSTAVGDEGGFAPDFRSNVEALDTILEAIGKAGYTAGEDIL
LGLDVASSEFYDNGKYNLVGENKRLTSEQFVDFLADWVAQYPIISIEDGLAEDDWAGWKL
LTERVGKKVQLVGDDLFVTNPKIFKQGIDSGTANAILIKVNQIGTLTETLEAIAMAHAAH
YASIVSHRSGETEDTTIADIAVATTATQIKTGSLCRSDRVAKYNQLLRIEQALGSGARYA
GRDAFVSLKR
Download sequence
Identical sequences Q3BUT0
316273.XCV1752 WP_011347100.1.100156 WP_011347100.1.10442 WP_011347100.1.11230 WP_011347100.1.12827 WP_011347100.1.13735 WP_011347100.1.17112 WP_011347100.1.199 WP_011347100.1.21303 WP_011347100.1.21317 WP_011347100.1.2259 WP_011347100.1.23534 WP_011347100.1.27112 WP_011347100.1.29361 WP_011347100.1.3003 WP_011347100.1.331 WP_011347100.1.37569 WP_011347100.1.37942 WP_011347100.1.39371 WP_011347100.1.40690 WP_011347100.1.43396 WP_011347100.1.44794 WP_011347100.1.46449 WP_011347100.1.46677 WP_011347100.1.49886 WP_011347100.1.54709 WP_011347100.1.55770 WP_011347100.1.59767 WP_011347100.1.60785 WP_011347100.1.64411 WP_011347100.1.66420 WP_011347100.1.67180 WP_011347100.1.67877 WP_011347100.1.6838 WP_011347100.1.75734 WP_011347100.1.772 WP_011347100.1.79359 WP_011347100.1.80975 WP_011347100.1.81489 WP_011347100.1.85024 WP_011347100.1.85152 WP_011347100.1.8544 WP_011347100.1.89212 WP_011347100.1.89360 WP_011347100.1.94781 WP_011347100.1.94946 WP_011347100.1.96073 WP_011347100.1.99285 gi|78047308|ref|YP_363483.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]