SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011501236.1.14473 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_011501236.1.14473
Domain Number - Region: 131-182
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000126
Family Pan module (APPLE domain) 0.023
Further Details:      
 
Domain Number - Region: 47-99
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000922
Family Pan module (APPLE domain) 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011501236.1.14473
Sequence length 184
Comment hypothetical protein [Rhodopseudomonas palustris]; AA=GCF_900110435.1; RF=na; TAX=1513892; STAX=1513892; NAME=Rhodopseudomonas pseudopalustris; strain=DSM 123; AL=Scaffold; RT=Major
Sequence
MRRGGSVRAWLFVLALAAAALAPRVAQAQANFDRPGADYLRAKVSSNDPADCALMCERDR
RCRSWTFAYPQAPEDGAFCWLKSSVPQRSPSNCCVSGVRGAGVLEPRNGSIEASIDRFGG
DYRNFELKANEADDACKAACEQDNKCRAWTYARPGYVGRNARCFLKNQIKPPQRKPGFFS
GVVR
Download sequence
Identical sequences A0A1H8TZ49 Q13CZ0
gi|91975291|ref|YP_567950.1| WP_011501236.1.14473 WP_011501236.1.68018 316057.RPD_0811

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]