SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011659210.1.59090 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_011659210.1.59090
Domain Number - Region: 168-229
Classification Level Classification E-value
Superfamily D-aminopeptidase, middle and C-terminal domains 0.0785
Family D-aminopeptidase, middle and C-terminal domains 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011659210.1.59090
Sequence length 246
Comment hypothetical protein [Burkholderia ambifaria]; AA=GCF_000203915.1; RF=na; TAX=339670; STAX=152480; NAME=Burkholderia ambifaria AMMD; strain=AMMD; AL=Complete Genome; RT=Major
Sequence
MSEPHALPPGATPDAASLPWLHPIAPPPAGRRTAFHALVCEFNLRPDRYLHVTRVPAEWP
ARYRSPDAFGPAGRKLLARHLLDANGVAAHHDFDVANPCARLALLPGAALEQLASYAGLL
LHRGWLRDALTVRRIRAEVAAKLGGDALELALERAPEFGALAETLEPWRADPAALPVVIR
ARGGRLLADFIGVAGDAVARRVRLKFNRAIDDEAPYWLNRTQRDQFGELLFLFLIPERLA
SWDWLF
Download sequence
Identical sequences Q0B7U6
339670.Bamb_4224 gi|115358973|ref|YP_776111.1| WP_011659210.1.34573 WP_011659210.1.59090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]