SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011921338.1.8883 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011921338.1.8883
Domain Number 1 Region: 69-150
Classification Level Classification E-value
Superfamily PUA domain-like 2.32e-17
Family PUA domain 0.0096
Further Details:      
 
Domain Number 2 Region: 2-65
Classification Level Classification E-value
Superfamily Pre-PUA domain 7.19e-16
Family Hypothetical protein Ta1423, N-terminal domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011921338.1.8883
Sequence length 155
Comment RNA-binding protein [Metallosphaera sedula]; AA=GCF_000016605.1; RF=representative genome; TAX=399549; STAX=43687; NAME=Metallosphaera sedula DSM 5348; strain=DSM 5348; AL=Complete Genome; RT=Major
Sequence
MQRHLLSQKEAKEFKEKVRNLYGVDLTSDKIEIGKEKRQLFYFVDDVLSFFGENLTPTLC
FLLKHRTNLPWVKIDEGAVKAVARGADLYAPGVVEHSGDVKPGRLLVVKTKLDQPVAIMN
TVEGADEALKNKRGKVASALHWIGDDMWNLCRSKS
Download sequence
Identical sequences A0A088E3H4 A4YD68
gi|146302978|ref|YP_001190294.1| 399549.Msed_0193 WP_011921338.1.15515 WP_011921338.1.27320 WP_011921338.1.28583 WP_011921338.1.31166 WP_011921338.1.34633 WP_011921338.1.8883 WP_011921338.1.99084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]