SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012664043.1.31717 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012664043.1.31717
Domain Number 1 Region: 2-362
Classification Level Classification E-value
Superfamily Homocysteine S-methyltransferase 5.76e-98
Family Homocysteine S-methyltransferase 0.00000567
Further Details:      
 
Domain Number 2 Region: 318-602
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 4.51e-66
Family Methylenetetrahydrofolate reductase 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012664043.1.31717
Sequence length 613
Comment bifunctional homocysteine S-methyltransferase/methylenetetrahydrofolate reductase [Staphylococcus carnosus]; AA=GCF_000009405.1; RF=na; TAX=396513; STAX=1281; NAME=Staphylococcus carnosus subsp. carnosus TM300; strain=TM300; AL=Complete Genome; RT=Major
Sequence
MSRFLQTLKENVLVADGAIGTILYSEGIDTCPEAYNITHPKKIEQIHRSYIQAGADVIQT
NTYGANFEKLQTFGLEHQVKDITRAAVRIAKKAANEDTFILGTVGGFKGVKQNELSLSTI
LYHTDIQIDTLIDEGVDALLFETYYDLNELLQVIRATKKKYDIPVIAQLTASNTNYLQDG
TEINEALKQVEAEGADVIGLNCHHGPHHMQQSFTHIELPQHALLSCYPNASLLDFENSSI
KYSDNASYFGKIAKSLVKEGVHLIGGCCGTTPEHIHYIKEAVEGLEPINEKKVIPIRRKS
NHPSIPVQKDNLTTKVKSGPTVIVELDTPKHLDTTKFFVNVTKLDKANVDAITLADNSLA
TVRVSNIAAASIIKQNYNIEPLVHITCRDRNLIGLQSHLLGLSLLGINEILAITGDPSKV
GHLPGANNVYDVNSKGLTELAVRFNQGLNIDGGALKTTTNFNIAGAFNPNVRKMEAAVRR
LDKKLDSGMNYFITQPVYTVEKIQEIAEKTAHLDSPFFIGIMPITSYRNAQFLHNEVPGI
TLPEDVLEQFEAVKDDKQKTKELSLRICRKLVDEVTKHFNGLYLITPFEQVDYSLELATY
FKTKTENNQEAII
Download sequence
Identical sequences B9DIA5
gi|224475507|ref|YP_002633113.1| 396513.Sca_0013 WP_012664043.1.31717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]