SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012713265.1.66823 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012713265.1.66823
Domain Number 1 Region: 3-152
Classification Level Classification E-value
Superfamily AF1862-like 3.4e-30
Family Cas Cmr5-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012713265.1.66823
Sequence length 154
Comment type III-B CRISPR module-associated protein Cmr5 [Sulfolobus islandicus]; AA=GCF_000022385.1; RF=representative genome; TAX=429572; STAX=43080; NAME=Sulfolobus islandicus L.S.2.15; strain=L.S.2.15; AL=Complete Genome; RT=Major
Sequence
MSYDDYKLALDAFNKVSNSLKGEARSKFRSRARDMVEEIYTSGFIPTLFYIISKAGLENN
DKIDKLTALLNSPSSENVDLGSSDEASYMAYLFVILYYLSERNIIDKKFLIDKLRCNRLE
IINTLYELSPIISARIKRYLMAIKRLAEAIIEVR
Download sequence
Identical sequences C3MN36
WP_012713265.1.66823 429572.LS215_0816 gi|227829742|ref|YP_002831521.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]