SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012859203.1.60729 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_012859203.1.60729
Domain Number - Region: 14-54
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.00948
Family VPS28 N-terminal domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_012859203.1.60729
Sequence length 78
Comment hypothetical protein [Streptobacillus moniliformis]; AA=GCF_001675725.1; RF=na; TAX=34105; STAX=34105; NAME=Streptobacillus moniliformis; strain=NCTC_10773; AL=Scaffold; RT=Major
Sequence
MTLKTTRIKLNKNIFAEIFFLNDTIYFFINESISKDEYKYTCLILINQIENNYGQDFKIY
RSNINNNTFNKTEKKLGV
Download sequence
Identical sequences D1AV96
gi|269123956|ref|YP_003306533.1| WP_012859203.1.12341 WP_012859203.1.14448 WP_012859203.1.21118 WP_012859203.1.22774 WP_012859203.1.29480 WP_012859203.1.40525 WP_012859203.1.48444 WP_012859203.1.49772 WP_012859203.1.52871 WP_012859203.1.54298 WP_012859203.1.55146 WP_012859203.1.60729 WP_012859203.1.82586 WP_012859203.1.85210 WP_012859203.1.98389 519441.Smon_1201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]