SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013024166.1.55774 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_013024166.1.55774
Domain Number - Region: 143-173
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0889
Family Second domain of FERM 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013024166.1.55774
Sequence length 204
Comment membrane protein [Pantoea ananatis]; AA=GCF_900167295.1; RF=na; TAX=553; STAX=553; NAME=Pantoea ananatis; strain=NFIX48; AL=Scaffold; RT=Major
Sequence
MDNIVQPAHIPHSRLEDALAILLGTLMVSFGVIMLKQAGALTGSTAGLAFLISYLSPMSF
GSAFFLINIPFYWLAVKRMGWEFTLKTFSAVGLVSLFTHLHPLFMHFSALNPFYAALFGN
VIMGIGFIVLFRHKASLGGINILALWLQDRFDIRAGKLQMAVDTCVVLASLFVVSLPMLL
ASVAGAVVLNVIIAMNHRPGRYRV
Download sequence
Identical sequences A0A0H3L2F0 A0A221NAH1 D4GHB8
WP_013024166.1.100875 WP_013024166.1.101504 WP_013024166.1.22816 WP_013024166.1.25584 WP_013024166.1.31804 WP_013024166.1.32245 WP_013024166.1.34141 WP_013024166.1.37529 WP_013024166.1.41207 WP_013024166.1.44942 WP_013024166.1.45452 WP_013024166.1.46475 WP_013024166.1.47668 WP_013024166.1.55774 WP_013024166.1.57057 WP_013024166.1.61179 WP_013024166.1.64732 WP_013024166.1.7182 WP_013024166.1.89124 WP_013024166.1.95616 gi|386018001|ref|YP_005936302.1| gi|291615819|ref|YP_003518561.1| gi|386081189|ref|YP_005994714.1| gi|378769110|ref|YP_005197585.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]