SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013155812.1.87825 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013155812.1.87825
Domain Number 1 Region: 3-363
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 2.22e-114
Family FMN-linked oxidoreductases 0.00000000183
Further Details:      
 
Domain Number 2 Region: 334-522
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 8.24e-42
Family N-terminal domain of adrenodoxin reductase-like 0.0000126
Further Details:      
 
Domain Number 3 Region: 461-535,570-647
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.42e-21
Family C-terminal domain of adrenodoxin reductase-like 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_013155812.1.87825
Sequence length 669
Comment NADPH-dependent 2,4-dienoyl-CoA reductase [Nocardiopsis dassonvillei]; AA=GCF_001877055.1; RF=na; TAX=2014; STAX=2014; NAME=Nocardiopsis dassonvillei; strain=NOCA502F; AL=Complete Genome; RT=Major
Sequence
MGDYPHLLEPLDLGFTTLANRVVMGSMHLGLEEAPGGFERMAAFYAERARGGVGLIVTGG
IAPNPEGATYKGAAKMTTEAEAEEHRVVTAAVHREGGRIAMQILHTGRYAFNEDSVAPSA
IQAPISAFTPRALTGDEVERTIEDFVRAAELARLAGYDGVEIMGSEGYLINQFVARATNR
REDDWGGSFENRMRFPVEIVRRVRERVGADFIVVYRLSMLDLVPGGSTFDEVVRLAKAVE
EAGATIINTGIGWHEARIPTIATSVPRGAYSWVTRRLRGRVSVPLVAVNRINTPEVAEAI
LAGGDADMVSLARPFLADPDFVAKAAAGTPEQINTCIGCNQACLDHTFSLKTSSCLVNPR
ACHETELVLSPTRLRRRVAVVGAGPAGLACSVSAAERGHEVTLFDAAGEIGGQLNLARRV
PGKQEFDETLRYYRVQLDRHGVDVRLGARVGAADLEGYDEVVLATGVTPRVPGIPGVDHP
KVVGYADVLRGSVEVGERVAVIGAGGIGFDVAAFLTDGGGDVDTGEFLRRWGVDTDPASR
GGLGEPRRPASPRTVHLVQRRAGKVGAGLGRTTGWIHRLELRHRGVETVAGAEYDRIDDE
GLHLTVDGEKRVLDVDTVVVCAGQEPLRDLADELTASGRAVHLIGGADEAAELDAKRAID
QGTRLAAAL
Download sequence
Identical sequences D7B0B7
gi|297563737|ref|YP_003682711.1| WP_013155812.1.70090 WP_013155812.1.87825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]