SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013764424.1.50710 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_013764424.1.50710
Domain Number - Region: 671-797
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 0.018
Family Proline dehydrohenase domain of bifunctional PutA protein 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_013764424.1.50710
Sequence length 2457
Comment cell surface protein SprA [Haliscomenobacter hydrossis]; AA=GCF_000212735.1; RF=representative genome; TAX=760192; STAX=2350; NAME=Haliscomenobacter hydrossis DSM 1100; strain=DSM 1100; AL=Complete Genome; RT=Major
Sequence
MNKTLLPFSLLLGIAVTLSAVDVAYHPTFMPGKMPGAKDHRTLTDTVPIKDRPDNFINAP
KRNPFDVRDPKAIDKNVEYDPATGNYIIEEKIGEDFFRPPSYMSFEEYTKYRQKQDEAAY
FNELSAKSRGKKDALNPLDPFSKIDIKKDLIDRLFGGSTIDIKPQGNVDLTFGYDYQRLE
NPILNLRQRDQFLFDFDMNIQMNVQGKIGEKLNLNTNYNTGATFDFDQVIKLNYDSQKFG
EDDILKKIEAGNVSMPLRGTLIQGAQSLFGIKTELQFGHLRLTGLVSQQKSERKNIQIQG
GSEQQEFDVKADEYDENRHFLLSHYNREAFEPALQNLPQIRSLFKLENIEVWITNDRNEV
DNVRDIVALADLGEGREEWLVNTNSVDLRPGAPKDITGIPLPDNRANNLYDRVIGQGDAR
AIEKSISTLQNQFGMVPTRDFEKVTARKLKPTEYTVHPELGFVSLRINVLPDQTVGVAYQ
YTYNGRSYKVGELSNNSENIRPDSSLNVLYVKLLKSTIQRTDIATWDLMMKNIYPTGATQ
VDQKEFRLDIYYEDPGKGVKRFLPETNLQGVPLLRVFNVDVLNIQGDPQPDGIFDFVPDL
TINTNTGRIMFPVLEPFGSSLLKKIKDTPAEIADKYIYQELYDSTLFRAQEFQEKNRYVI
KGTYKSSVSSEISLGAFNIPQGSVKVSGGGQQLVEGRDYEIDYNLGRVRILNDAILASGA
QINISLEDNTLFGFQNRSMMGLRADYEFDKNFNIGATIMKLWERPFTQKVNIGEDPINNN
VYGFDVNFKREAPWLTKLVDAIPGMSTKAPSSISFTGELAAIRPGHAKAINQNRKDKGGV
VYVDDFEGANNTFDLRQPIINWYLSSAPSDQNSSNPAARPEALFRDDVTYGYNRAKMSWY
RIDNFGLRSGQQDNVNPYTRVIPQNEVFPNRQLQLTELPNIQTLDIVFNPRERGPYNFEQ
PNGSPFSSGLEFVGGETFLKNPKSRWGGMMRALTINDFQAANIEFLEFWMLSPFLNEDGS
GTASPDAEKKQGYLTFQLGNISEDILKDGLRFFENGLPSNFNKDRRTKETSWSKVPLTQQ
VTAAFDNDTTSRRLQDVGLDGLNDAGERNKFAPWLNSIRAVNTNAAARLEQDPSGDNFRF
WNDPSFPDNVDVVTRYRDFNNPEGNSETNTSRQSQNSSTNNPDAEDLNFDNTLNETEAYF
QYRIPIFHDKDGELNLDSARLRNGGVKLVTDRIEKEGRVWYRFRMPLSQFDRAVGGIRDF
RSIRFMRVLMDGFESQVNLRFATLEFVRNQWRKYTQDLSPSTVACDNLTVFEVDAVNIEE
NTDPSEARPFAYVLPLGIQREQSIGGVINTLQNEQSLALTLQDLCDGKEKAVFKNIGLDM
RVYERFKMYVHAEKFDQNQGPDSSGLRIFVRMGSDFKNNYYEYEMPLVFSELDRLPPMTG
GTNPVILPAYKEEVWRIENEFDFPLNLLRQVKEERNATSGSNLDQEYIKPISVTLENGQI
VERWVKVRGNPNLGNSKIVMIGIRNPQGGSNNASAVVWANEMRLTGLDERGGVAGIARLD
VQMADLGNVTVAGNFGTIGYGAIDQKVQQRSRFDNSGFDIAGNLELNKFLPKDWNLRLPF
YAQYSRNVETPEYDPYDLDIILKEKIRKTDNATVRDSIQRTTQEISTVKSYNFTNVRKDR
SPQNQGKPMPWDISNFSVSYGYTALERSDPFIESDQLEKYNGGVNYQFSTQTKYIQPFKK
LKGSALKLISEINFNPLPSTFTFSTLMDRQFQTTKYRFTDLDPKYSTFFNKRFLWGRDYN
LQWDFTKGLKFNFNAANDAVVDEPDESLLREKGFSLAEQNRYRRDSIWSNIQNLGRTKNY
QHEFTLNYTLPTKLIPYMEWVAIKGQYRGNYGWTAAALNTDSLGNVIQNGQNIQANADFN
FDQLYNKIPFLRKIDQGPRSGGAEGNPRTRRTDEANADKDKEKKGGGDLPNGVKLLLRPL
LSLRKARFNYSEQHNTVVPGYTPASRLFGMNQFNSPGWDFVAGIQPRISKLREDEFGTGK
DWLAQAANQGWMSSSVFQNREVSQLSTQNWDARVTIEPFRDMRLDLDISRNYTQNHSQYF
KDTLLDNNARFVHAIPQDIGTLTMSYSALKTLFRGDTADLRTLFKTFEDNRVIISQRLGN
GEHVDTTLAQQGYTYGYGRTQQEVLIPAFLAAYTGQDPRGINLNLFELLPQINWRFTYNG
LSRLPFFKEFFQSFSLTHGYKSSLTINTFNTGLDFLRTRDEGFLNELNNNFYPRLEVPEL
VIQEGFNPLIAVSAALKNGMSFNFDYKLTRNLAMSFVSNQLAETRRKEIVFGFGHKINDF
DISSIFGKTKKKKRPAPKPPTTGGNPASTAIAPRGLDLQFNFSLSDDVTFNHLLDQGVRE
PTRGSYNLSISPSAEYKLNQRLSLRFFVDYRRSEPKTSAGYPRTDSSGGVVVRFALQ
Download sequence
Identical sequences F4L6M8
WP_013764424.1.50710 gi|332663956|ref|YP_004446744.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]