SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013839411.1.6766 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013839411.1.6766
Domain Number 1 Region: 6-296
Classification Level Classification E-value
Superfamily ATP synthase (F1-ATPase), gamma subunit 1.19e-70
Family ATP synthase (F1-ATPase), gamma subunit 0.0000639
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013839411.1.6766
Sequence length 299
Comment F0F1 ATP synthase subunit gamma [Isoptericola variabilis]; AA=GCF_000215105.1; RF=representative genome; TAX=743718; STAX=139208; NAME=Isoptericola variabilis 225; strain=225; AL=Complete Genome; RT=Major
Sequence
MAGGSQRVYKQRIKSTQSLKKMFRAQELIAASRIGKARARTAAATPYERAITRAVSAVAT
HSSTNHPLTSERDDTNRVAVLVIGADRGQAGAYSASLVRETEKLVAQLRAEGKEVSLYAT
GRRAIAFYRYRKRELAAEWSYGSENPQVDVATEVADTMLGAFLAPAEEGGVAELHVVYTQ
FVNMVTQRPRVVRMLPLEVVEGVAVPGEHQALPLYDFEPSPEVVLDALLPRYVRSRIFAF
MLDAAASELAARQRAMHTATDNAEDLIRTYTRLANQARQADITQEISEIVSGADALAAS
Download sequence
Identical sequences F6FR70
WP_013839411.1.6766 gi|334337762|ref|YP_004542914.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]