SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013876786.1.15103 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_013876786.1.15103
Domain Number - Region: 124-155
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 0.0837
Family Skp1 dimerisation domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_013876786.1.15103
Sequence length 164
Comment hypothetical protein [Parageobacillus thermoglucosidans]; AA=GCF_000178395.2; RF=na; TAX=634956; STAX=1426; NAME=Parageobacillus thermoglucosidasius C56-YS93; strain=C56-YS93; AL=Complete Genome; RT=Major
Sequence
MKRTAVMAACLLSFGIIMGACSDDKANNAKDDHSASYTTNSGDIRETTKSIDHLPKFLNN
FEEDMAVLYQQAAKHKDLLKHIPCYCGCGESAGHQNNYDCFVYETKKDGSVVWDDHATKC
GVCLEIAKESIASYEQGKSVKEIRQMIDEKYKEGYAEPTPTKSL
Download sequence
Identical sequences WP_013876786.1.15103 gi|336235058|ref|YP_004587674.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]