SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015646549.1.66300 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_015646549.1.66300
Domain Number - Region: 2-34
Classification Level Classification E-value
Superfamily Ribosomal protein L29 (L29p) 0.0719
Family Ribosomal protein L29 (L29p) 0.011
Further Details:      
 
Domain Number - Region: 25-56
Classification Level Classification E-value
Superfamily Trimerization domain of TRAF 0.0863
Family Trimerization domain of TRAF 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_015646549.1.66300
Sequence length 99
Comment hypothetical protein [Streptococcus suis]; AA=GCF_000440615.1; RF=na; TAX=1214169; STAX=1307; NAME=Streptococcus suis 89-2479; strain=89-2479; AL=Contig; RT=Major
Sequence
MLNAKDLRKLKRSELFELLVEQAKEIESYQAKLVDLEKRIEYREVVLGEIGSIVEASLAV
TRIFEEAQLAANIYLEQVQKVTHKQSDNCEIGRIDEDGD
Download sequence
Identical sequences A0A0N1J3Z0
WP_015646549.1.102003 WP_015646549.1.10904 WP_015646549.1.12368 WP_015646549.1.15035 WP_015646549.1.17549 WP_015646549.1.17730 WP_015646549.1.24550 WP_015646549.1.32258 WP_015646549.1.33254 WP_015646549.1.33353 WP_015646549.1.35749 WP_015646549.1.40169 WP_015646549.1.41522 WP_015646549.1.42735 WP_015646549.1.44612 WP_015646549.1.50635 WP_015646549.1.54343 WP_015646549.1.55864 WP_015646549.1.60184 WP_015646549.1.60233 WP_015646549.1.60862 WP_015646549.1.64009 WP_015646549.1.66186 WP_015646549.1.66300 WP_015646549.1.66360 WP_015646549.1.70301 WP_015646549.1.72185 WP_015646549.1.72924 WP_015646549.1.74368 WP_015646549.1.75643 WP_015646549.1.76811 WP_015646549.1.80787 WP_015646549.1.89981 WP_015646549.1.94587 WP_015646549.1.99664 gi|499142814|ref|YP_007974878.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]