SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015837377.1.50895 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_015837377.1.50895
Domain Number - Region: 35-55
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0523
Family Retrovirus zinc finger-like domains 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_015837377.1.50895
Sequence length 60
Comment hypothetical protein [Geobacter sp. M21]; AA=GCF_000023645.1; RF=na; TAX=443144; STAX=443144; NAME=Geobacter sp. M21; strain=M21; AL=Complete Genome; RT=Major
Sequence
METNKTCQCGAKHTGHICMLKSAGRGEEIAHISDHPTVTCFTCGAEANSADNVCNPMPIE
Download sequence
Identical sequences C6E942
443144.GM21_2085 gi|253700706|ref|YP_003021895.1| WP_015837377.1.50895

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]