SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015981506.1.43519 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_015981506.1.43519
Domain Number - Region: 14-80
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.00883
Family Insect pheromone/odorant-binding proteins 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_015981506.1.43519
Sequence length 102
Comment MULTISPECIES: hypothetical protein [Clostridiales]; AA=GCF_900014235.1; RF=na; TAX=1496; STAX=1496; NAME=Clostridioides difficile; AL=Contig; RT=Major
Sequence
MGSSNSLSEVIELQKVRIIPENYGLTKEDLTEKDLYCMAKHIQINVIKRCFREEHDILDP
CQTCKYERECFKSGYGYAHWDTFIKLSKITGVRMCPGAGFVD
Download sequence
Identical sequences A0A069AQR2 Q24LH7
gi|90592657|ref|YP_529572.1| WP_015981506.1.11398 WP_015981506.1.11937 WP_015981506.1.17611 WP_015981506.1.22568 WP_015981506.1.23096 WP_015981506.1.24987 WP_015981506.1.25416 WP_015981506.1.26494 WP_015981506.1.26940 WP_015981506.1.28638 WP_015981506.1.32294 WP_015981506.1.36078 WP_015981506.1.38924 WP_015981506.1.4137 WP_015981506.1.42035 WP_015981506.1.43112 WP_015981506.1.43519 WP_015981506.1.43579 WP_015981506.1.49020 WP_015981506.1.49065 WP_015981506.1.58015 WP_015981506.1.5905 WP_015981506.1.59752 WP_015981506.1.63570 WP_015981506.1.66439 WP_015981506.1.66608 WP_015981506.1.71384 WP_015981506.1.74126 WP_015981506.1.75026 WP_015981506.1.77842 WP_015981506.1.81035 WP_015981506.1.81299 WP_015981506.1.82150 WP_015981506.1.85127 WP_015981506.1.89052 WP_015981506.1.89629 WP_015981506.1.9393 WP_015981506.1.94968 YP_529572.1.98992 Q24LH7_9CAUD

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]