SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_016471373.1.79071 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_016471373.1.79071
Domain Number - Region: 15-55
Classification Level Classification E-value
Superfamily D-aminopeptidase, middle and C-terminal domains 0.0471
Family D-aminopeptidase, middle and C-terminal domains 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_016471373.1.79071
Sequence length 78
Comment MULTISPECIES: DUF397 domain-containing protein [Streptomyces]; AA=GCF_001418505.1; RF=na; TAX=67300; STAX=67300; NAME=Streptomyces flocculus; strain=NRRL B-2465; AL=Scaffold; RT=Major
Sequence
MGRIYNGMPAAHLGSEGWRKPWSGGNGGSCVEALKLADGRVALRQSTDPDGPALICSRSD
ISGFIRAAKAGEADFLVA
Download sequence
Identical sequences A0A0N0HVX4 S3BS72
WP_016471373.1.12207 WP_016471373.1.2996 WP_016471373.1.33505 WP_016471373.1.44650 WP_016471373.1.52125 WP_016471373.1.65030 WP_016471373.1.6806 WP_016471373.1.73898 WP_016471373.1.79071 WP_016471373.1.79323 WP_016471373.1.92217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]