SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_018666191.1.73053 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_018666191.1.73053
Domain Number 1 Region: 21-213
Classification Level Classification E-value
Superfamily PG1388-like 2.09e-69
Family PG1388-like 0.0000999
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_018666191.1.73053
Sequence length 216
Comment hypothetical protein [Bacteroides gallinarum]; AA=GCF_000374365.1; RF=na; TAX=1121096; STAX=376806; NAME=Bacteroides gallinarum DSM 18171 = JCM 13658; strain=DSM 18171; AL=Scaffold; RT=Major
Sequence
MMKKLVVFLFVICMGAGSLPAQSAKACFTSMPDSLSPLLTAVNRADFIDFLESKMKAEVT
NRLGGKSEMTELTSDYIRVQVAPQSSWQMKLLAVNDTTRLICTVATVCAPACDSHIDFYT
SDWKKLPSSSYLPALPAMDDFIAPASDTTDVYRYQDARLQADMLLMKADLSAGDATLIFT
FTTPDYMEKEAAEKLKPFLRHPVSYVWKEGKFVRSE
Download sequence
Identical sequences WP_018666191.1.61603 WP_018666191.1.73053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]