SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_020841218.1.91202 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_020841218.1.91202
Domain Number - Region: 79-141
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0235
Family LacY-like proton/sugar symporter 0.053
Further Details:      
 
Domain Number - Region: 158-229
Classification Level Classification E-value
Superfamily Nucleocapsid protein dimerization domain 0.0305
Family Coronavirus nucleocapsid protein 0.0069
Further Details:      
 
Domain Number - Region: 35-83
Classification Level Classification E-value
Superfamily NusB-like 0.0425
Family Antitermination factor NusB 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_020841218.1.91202
Sequence length 322
Comment pilus assembly protein TadB [Vibrio parahaemolyticus]; AA=GCF_001728575.1; RF=na; TAX=670; STAX=670; NAME=Vibrio parahaemolyticus; strain=CDC_K5579; AL=Contig; RT=Major
Sequence
MESQFPLFLLLLFLSVFFISQALILPSAGKKVKHKQLIKRIHESHKHIDQESISLLRENS
LKNLSPLERWLIRFSLFESFKKKLELAGISMGFSRVIFFTFLSGVAVGLLLYLWGQVWYL
CAGVAVACWVSAYFYLQKKIADRLMKFEEQLPEALDIIKRVLQAGQPITQAFGEVGREVS
APLGPEFLNTFNLLNYGYDLRLAIMQMSERTPTVSMLAFSSAVLLQKETGGNLVENIEKL
SHILRARFKLARKIKTISAESRMSAWVLVLAPFALYVIISLVRPEYIELLHTHPMGIKMV
IGGMVALFIGTLWIRKIVNIEV
Download sequence
Identical sequences A0A0D1FL29 A0A2H1B4L5 S5IN79
WP_020841218.1.100407 WP_020841218.1.102137 WP_020841218.1.12227 WP_020841218.1.16556 WP_020841218.1.25529 WP_020841218.1.27385 WP_020841218.1.2846 WP_020841218.1.28858 WP_020841218.1.29784 WP_020841218.1.31829 WP_020841218.1.3371 WP_020841218.1.36558 WP_020841218.1.37931 WP_020841218.1.40049 WP_020841218.1.42872 WP_020841218.1.45497 WP_020841218.1.45795 WP_020841218.1.50687 WP_020841218.1.56677 WP_020841218.1.63301 WP_020841218.1.65123 WP_020841218.1.65524 WP_020841218.1.68046 WP_020841218.1.69768 WP_020841218.1.69774 WP_020841218.1.70381 WP_020841218.1.72063 WP_020841218.1.74480 WP_020841218.1.79702 WP_020841218.1.80498 WP_020841218.1.8069 WP_020841218.1.84362 WP_020841218.1.8729 WP_020841218.1.91202 WP_020841218.1.92867

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]