SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_021033770.1.95088 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_021033770.1.95088
Domain Number 1 Region: 7-77
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000000564
Family Tetracyclin repressor-like, N-terminal domain 0.0032
Further Details:      
 
Weak hits

Sequence:  WP_021033770.1.95088
Domain Number - Region: 128-198
Classification Level Classification E-value
Superfamily PG1388-like 0.0392
Family PG1388-like 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_021033770.1.95088
Sequence length 211
Comment TetR family transcriptional regulator [Campylobacter coli]; AA=GCF_001488735.1; RF=na; TAX=195; STAX=195; NAME=Campylobacter coli; AL=Contig; RT=Major
Sequence
MNPNKTPSKKVLARREKIKNVAFDLFLTKGFQETSLSDIIKLSGGSYSNIYDSFNSKEGL
FFEILDDVCKKHFDLIASQTQTIKDKNLKEFLTSFGLTFVDIFNQVQTVAFGKIIFSQVY
DKHKHVKNWIENNQKIFSYSVLIELFKKQDSSYISNNAQKLAMLFCAMLREPYHSLNVLA
DTPLMNKQEQKEHVEFIVNIFLKGIENKTSI
Download sequence
Identical sequences A0A2A4L336 W8KH72
WP_021033770.1.101300 WP_021033770.1.101903 WP_021033770.1.10390 WP_021033770.1.12171 WP_021033770.1.14768 WP_021033770.1.18098 WP_021033770.1.23369 WP_021033770.1.26250 WP_021033770.1.29854 WP_021033770.1.31606 WP_021033770.1.34218 WP_021033770.1.37065 WP_021033770.1.39919 WP_021033770.1.40202 WP_021033770.1.40351 WP_021033770.1.42000 WP_021033770.1.46557 WP_021033770.1.47889 WP_021033770.1.50435 WP_021033770.1.52450 WP_021033770.1.52696 WP_021033770.1.53698 WP_021033770.1.55659 WP_021033770.1.57666 WP_021033770.1.59790 WP_021033770.1.59992 WP_021033770.1.61829 WP_021033770.1.6548 WP_021033770.1.67934 WP_021033770.1.68218 WP_021033770.1.69529 WP_021033770.1.70744 WP_021033770.1.71304 WP_021033770.1.73647 WP_021033770.1.75057 WP_021033770.1.80722 WP_021033770.1.92517 WP_021033770.1.95088 WP_021033770.1.99699 gi|543941278|ref|YP_008534044.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]