SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_021369971.1.12629 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_021369971.1.12629
Domain Number - Region: 7-39
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.0942
Family Insect pheromone/odorant-binding proteins 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_021369971.1.12629
Sequence length 61
Comment MULTISPECIES: hypothetical protein [Clostridiales]; AA=GCF_000449305.2; RF=na; TAX=1151286; STAX=1496; NAME=Clostridioides difficile CD131; strain=CD131; AL=Contig; RT=Minor
Sequence
MKINVHVKTNKIGSDCELELEIDDDDLKDMSDEEREDYIDKIAWDYALENLIDWNWYKIE
D
Download sequence
Identical sequences A0A1R2FAF7
WP_021369971.1.12629 WP_021369971.1.141 WP_021369971.1.14848 WP_021369971.1.19648 WP_021369971.1.24457 WP_021369971.1.24520 WP_021369971.1.27967 WP_021369971.1.3024 WP_021369971.1.33056 WP_021369971.1.34388 WP_021369971.1.36257 WP_021369971.1.37981 WP_021369971.1.40775 WP_021369971.1.52330 WP_021369971.1.54058 WP_021369971.1.55391 WP_021369971.1.559 WP_021369971.1.5750 WP_021369971.1.60957 WP_021369971.1.64020 WP_021369971.1.64859 WP_021369971.1.70710 WP_021369971.1.78949 WP_021369971.1.80455 WP_021369971.1.82169 WP_021369971.1.85420 WP_021369971.1.90164 WP_021369971.1.92371 WP_021369971.1.97672 WP_021369971.1.99545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]