SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_021542226.1.17595 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_021542226.1.17595
Domain Number - Region: 107-138
Classification Level Classification E-value
Superfamily BEACH domain 0.0785
Family BEACH domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_021542226.1.17595
Sequence length 160
Comment hypothetical protein [Escherichia coli]; AA=GCF_002225985.1; RF=na; TAX=562; STAX=562; NAME=Escherichia coli; strain=MOD1-EC5734; AL=Contig; RT=Major
Sequence
MIDYKKNLLFILVFISGFMLFTVYSYTAEKMIYNETCTANWVIFNDQGRANLTIDFMYNK
KNKTGTVALSGTWQQGNRESKSIRRNIEYTWIENYDTAHLTSKKVNKFEIMDQVDDDRLA
ELIPDFYVFPEKSVSYNILKQGKHAFILSIGNRAIMHCAR
Download sequence
Identical sequences WP_021542226.1.17595 WP_021542226.1.40563 WP_021542226.1.4646 WP_021542226.1.57638 WP_021542226.1.75360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]