SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_021640752.1.34012 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_021640752.1.34012
Domain Number - Region: 19-60
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.0569
Family VPS23 C-terminal domain 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_021640752.1.34012
Sequence length 71
Comment hypothetical protein [[Clostridium] symbiosum]; AA=GCF_000466485.1; RF=na; TAX=411472; STAX=1512; NAME=[Clostridium] symbiosum ATCC 14940; strain=ATCC 14940; AL=Scaffold; RT=Major
Sequence
MNVRNEIKAQIVRAGFTMQDVVDRLSDEYGWSDSVSNLSAKLQRESIRYKEVVELADVLG
YDIVWQKRRDR
Download sequence
Identical sequences U2B9W0
WP_021640752.1.34012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]