SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_022533062.1.58722 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_022533062.1.58722
Domain Number 1 Region: 3-50
Classification Level Classification E-value
Superfamily Ribosomal protein L39e 9.02e-16
Family Ribosomal protein L39e 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_022533062.1.58722
Sequence length 51
Comment 50S ribosomal protein L39e [Candidatus Methanomethylophilus alvus]; AA=GCF_000300255.2; RF=na; TAX=1236689; STAX=1291540; NAME=Candidatus Methanomethylophilus alvus Mx1201; strain=Mx1201; AL=Complete Genome; RT=Major
Sequence
MSSTKPPAMKERLNKKVKQNRRVPAWVMLRTNRQFLRHPKRRSWRMGKLKE
Download sequence
Identical sequences R7Q3G6
WP_022533062.1.58722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]