SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_022645569.1.77950 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_022645569.1.77950
Domain Number - Region: 58-72
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0628
Family Retrovirus zinc finger-like domains 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_022645569.1.77950
Sequence length 80
Comment hypothetical protein [Escherichia coli]; AA=GCF_000522285.1; RF=na; TAX=1328437; STAX=562; NAME=Escherichia coli BIDMC 3; strain=BIDMC 3; AL=Scaffold; RT=Major
Sequence
MKEIIAKTSSAKEIAVPWFETMGKQVGLSKRTTAAILREQQLRIRKLNRVSARILSDAIK
RGEHWWEDCSGQVILATVLQ
Download sequence
Identical sequences A0A0A1A9A0 A0A168HKL0
WP_022645569.1.101439 WP_022645569.1.14322 WP_022645569.1.14946 WP_022645569.1.23869 WP_022645569.1.24577 WP_022645569.1.30397 WP_022645569.1.3796 WP_022645569.1.40 WP_022645569.1.43216 WP_022645569.1.52137 WP_022645569.1.562 WP_022645569.1.62322 WP_022645569.1.68071 WP_022645569.1.74574 WP_022645569.1.77419 WP_022645569.1.77950 WP_022645569.1.87491 WP_022645569.1.94367 WP_022645569.1.94436 WP_022645569.1.96650 WP_022645569.1.9723 WP_022645569.1.97269 WP_022645569.1.99349

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]