SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_023109877.1.30081 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_023109877.1.30081
Domain Number 1 Region: 168-231
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.96e-20
Family FtsK C-terminal domain-like 0.00068
Further Details:      
 
Weak hits

Sequence:  WP_023109877.1.30081
Domain Number - Region: 251-310
Classification Level Classification E-value
Superfamily D-aminopeptidase, middle and C-terminal domains 0.0418
Family D-aminopeptidase, middle and C-terminal domains 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_023109877.1.30081
Sequence length 329
Comment hypothetical protein [Pseudomonas aeruginosa]; AA=GCF_000481125.1; RF=na; TAX=1402542; STAX=287; NAME=Pseudomonas aeruginosa BL01; strain=BL01; AL=Scaffold; RT=Major
Sequence
MTAQTAATIAQDPVEEFDEEQPATVVSLAAETLGRDLLQALLQEVRVLPDVWPKLTEKKQ
ADVIDRLRSTVERTVKYAVKLISAGERPAIGGILESVAIKEGIKATFKVSQFDPLRHDLI
DRAGKVCMLVVADAEEYLQGMDTVVPDPDQSALALDESDDGDDAGGTGAQDPLYIEAVSH
VIDTRRVSISGLQRYLKIGYNRAARIVEEMEAAGVVSAPNSNGEREVILQSPPEPEKDLL
SSAPEPGATTYGGHTIDDITVLVLRKDEITPGWLQSRFALSTDESLAVAMKLLDDGVITL
ATEGESPDLNTYRVAVATKAPAEEPITLE
Download sequence
Identical sequences WP_023109877.1.30081 WP_023109877.1.94450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]