SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_023130712.1.56348 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_023130712.1.56348
Domain Number 1 Region: 161-225
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 6.8e-19
Family FtsK C-terminal domain-like 0.00082
Further Details:      
 
Weak hits

Sequence:  WP_023130712.1.56348
Domain Number - Region: 245-304
Classification Level Classification E-value
Superfamily D-aminopeptidase, middle and C-terminal domains 0.0497
Family D-aminopeptidase, middle and C-terminal domains 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_023130712.1.56348
Sequence length 323
Comment hypothetical protein [Pseudomonas aeruginosa]; AA=GCF_000481905.1; RF=na; TAX=1402490; STAX=287; NAME=Pseudomonas aeruginosa CF27; strain=CF27; AL=Scaffold; RT=Major
Sequence
MKAEHREIIDRAKLHGYYPSTIAHELLERDLVNTVVTELRSVRVPFHLLKEDEQQEVIDR
IAESVSEVTRVAISIIASRGAVSVPVDMKAIKVEAKTMTITAKVDGAEPNKHELTDAAGK
LCLLVMAPSDYDEGLDDVRPDRDQHEMPLHAGNVAEGLLGDGSEDQLYLEAVAHVRDTRQ
ATISSIQRHLKIGYNRAARIVEAMEVARVVSAPNSNGEREVILQSPPEPEKDLLSSAAEP
GATTYGGHTIDDITVLVLRKDEITPGWLQSRFALSTDESLAVALKLLDDGVITLATEGES
PDLNTYRVAVATKAPAEEPITLE
Download sequence
Identical sequences WP_023130712.1.56348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]