SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_023236937.1.20789 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_023236937.1.20789
Domain Number - Region: 87-121
Classification Level Classification E-value
Superfamily D-aminopeptidase, middle and C-terminal domains 0.034
Family D-aminopeptidase, middle and C-terminal domains 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_023236937.1.20789
Sequence length 273
Comment hypothetical protein [Salmonella enterica]; AA=GCF_001245025.1; RF=na; TAX=149391; STAX=28901; NAME=Salmonella enterica subsp. enterica serovar Braenderup; strain=CVM N48701; AL=Contig; RT=Major
Sequence
MALSASEKRYADGSPALREQWHYRGGFELLAKEARAANDDTSDFYPILIGPDGAPQEMYS
ANGRKVWRRQRSLWGLAAANDASPDARESCDAGFMGQWQDEESGLWYNLHRYYNARTGQY
LSPDPLRLAGGLNTYGYVHNPLTWADPYGLAGCSAQFKSRNEAFRAAKRDAGIPMNQQPD
RIFNSKTGFFSDHRNVPMTDSRKNPIFDNNGNQVWTREYQFTRADGSKIIIQDHSAGHSY
ADGVGNQGSHLNVRPIENTRTGSVPGTFDHYEF
Download sequence
Identical sequences WP_023236937.1.100584 WP_023236937.1.15612 WP_023236937.1.20789 WP_023236937.1.24444 WP_023236937.1.25072 WP_023236937.1.45535 WP_023236937.1.50285 WP_023236937.1.55477 WP_023236937.1.72968 WP_023236937.1.73596 WP_023236937.1.95744 WP_023236937.1.98402

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]