SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_023483272.1.32865 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_023483272.1.32865
Domain Number - Region: 115-137
Classification Level Classification E-value
Superfamily C-terminal domain of mollusc hemocyanin 0.051
Family C-terminal domain of mollusc hemocyanin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_023483272.1.32865
Sequence length 311
Comment hypothetical protein [Paenibacillus larvae]; AA=GCF_000511405.1; RF=na; TAX=697284; STAX=1464; NAME=Paenibacillus larvae subsp. larvae DSM 25430; strain=DSM 25430; AL=Complete Genome; RT=Major
Sequence
MAFLLKDWLHADGQKHTYLIFKEVYPFSDLRRLEQLADKLYDAGIPFIVSIRPVFSNTDY
PAMKRYLETLKYVQARNGSILVNAPVVASAISQNDQNLKAQMESFVDVLADNGIAPLGMG
VEMYWSYDRKYTADAMGFFNSGILFPNEKLMYKSRSDSSEPFTSSMYSLKMSFLKQFKRS
GKALGEFPMNMAITYDFFKDKTQLDQAVQELVDSWITFADYKYGYHEVRTQANTISSRNG
SLLINGHNVDLNNSVKSISSDYTYRQEEQKSFTALFNVQNKIFITFILMTLIAFGIFIII
GHRLYKRKYFK
Download sequence
Identical sequences A0A2A5JXN5 V9WAA2
WP_023483272.1.2936 WP_023483272.1.32865 WP_023483272.1.33316 WP_023483272.1.35586 WP_023483272.1.96379 gi|568265246|ref|YP_008968721.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]