SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_033784261.1.1595 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_033784261.1.1595
Domain Number - Region: 54-107
Classification Level Classification E-value
Superfamily Nucleocapsid protein dimerization domain 0.00118
Family Coronavirus nucleocapsid protein 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_033784261.1.1595
Sequence length 170
Comment hypothetical protein [Enterococcus faecalis]; AA=GCF_001054785.1; RF=na; TAX=1351; STAX=1351; NAME=Enterococcus faecalis; strain=258.rep2_EFLS; AL=Scaffold; RT=Major
Sequence
MTTDIVQLKENGTVKYMKTHADAIDGIEGKLVKAVGNETILGTKDFQDGCLSKGNAVLTQ
NGLKYKSFTPTDLDSLQGGSVTFERYGDIVTVQFTIQTRIDKDFAKDQTIVWGIPAEFQP
NTDKLFPLINSVGSGGIVKFVSGVRISAQTTIAKNTWYWGTIAYIAKNRL
Download sequence
Identical sequences WP_033784261.1.1595 WP_033784261.1.72635 WP_033784261.1.78447

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]