SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_038535338.1.6285 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_038535338.1.6285
Domain Number 1 Region: 3-62
Classification Level Classification E-value
Superfamily Replisome organizer (g39p helicase loader/inhibitor protein) 0.0000105
Family Replisome organizer (g39p helicase loader/inhibitor protein) 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_038535338.1.6285
Sequence length 110
Comment hypothetical protein [Bacillus sp. X1(2014)]; AA=GCF_000747345.1; RF=na; TAX=1565991; STAX=1565991; NAME=Bacillus sp. X1(2014); strain=X1; AL=Complete Genome; RT=Major
Sequence
MNKRETFTLLKMIWNFYDQFVVDQDKVNYWYEAMKDWPLEEVQKNLLEFVRQSPYPPKVS
ELAPNKTTNAMSVPNLEETKVIITRKHKPASEEVAQRSMAQMRAILGIER
Download sequence
Identical sequences A0A077J324
WP_038535338.1.6285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]