SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_041056135.1.1358 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_041056135.1.1358
Domain Number 1 Region: 1-63
Classification Level Classification E-value
Superfamily Replisome organizer (g39p helicase loader/inhibitor protein) 0.00000000288
Family Replisome organizer (g39p helicase loader/inhibitor protein) 0.00096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_041056135.1.1358
Sequence length 118
Comment hypothetical protein [Bacillus subtilis]; AA=GCF_000830715.1; RF=na; TAX=1423; STAX=1423; NAME=Bacillus subtilis; strain=B4073; AL=Scaffold; RT=Major
Sequence
MIKKQTFEIMSLIKQYFEHFEITQEKIDSWHELLQEAEYEEVRRNLINFCRLNKFPPKVA
DLLNAKPTTVDRMNAIPSVEETKEYLAKMSAPAELTEQERASIEKSKAEIRRMLGIGD
Download sequence
Identical sequences WP_041056135.1.1358 WP_041056135.1.69439 WP_041056135.1.7159

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]