SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_042595817.1.97821 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_042595817.1.97821
Domain Number 1 Region: 1-64
Classification Level Classification E-value
Superfamily Replisome organizer (g39p helicase loader/inhibitor protein) 0.00000144
Family Replisome organizer (g39p helicase loader/inhibitor protein) 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_042595817.1.97821
Sequence length 112
Comment hypothetical protein [Bacillus thuringiensis]; AA=GCF_000833655.1; RF=na; TAX=1441; STAX=1428; NAME=Bacillus thuringiensis serovar morrisoni; strain=HD 600; AL=Contig; RT=Major
Sequence
MIKKETFELLKMIQAVFTNFDITQEKIDTWTVILKEYEFEEIKANYIAYIQTAKFAPKPS
DIIKIKNQEHKVAPNIQETRAYWSKYSQDQLATKEEREVYLKEMRSILGIER
Download sequence
Identical sequences A0A0G4CUY5
WP_042595817.1.93683 WP_042595817.1.97821

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]