SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_046402076.1.22695 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_046402076.1.22695
Domain Number 1 Region: 17-51
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000356
Family Retrovirus zinc finger-like domains 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_046402076.1.22695
Sequence length 66
Comment MULTISPECIES: hypothetical protein [Gammaproteobacteria]; AA=GCF_000978665.1; RF=na; TAX=670; STAX=670; NAME=Vibrio parahaemolyticus; strain=Vp103; AL=Contig; RT=Major
Sequence
MSYTYCTYCGSQLHTYANFPQTWGGSSRRANLRCGYCGQSGHNSNACQHNASSGRRRSLN
DDFHLD
Download sequence
Identical sequences A0A0M3EDC5 A0A140T6L2
WP_046402076.1.22695 WP_046402076.1.29943 WP_046402076.1.4055 WP_046402076.1.53731

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]