SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_051412066.1.56524 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_051412066.1.56524
Domain Number 1 Region: 4-89
Classification Level Classification E-value
Superfamily AF1862-like 0.0000000000248
Family Cas Cmr5-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_051412066.1.56524
Sequence length 131
Comment hypothetical protein [Halonatronum saccharophilum]; AA=GCF_000517025.1; RF=representative genome; TAX=926692; STAX=150060; NAME=Halonatronum saccharophilum DSM 13868; strain=DSM 13868; AL=Scaffold; RT=Major
Sequence
MSKKRIEEYIPKAIKLIEEEKIAKEGKVPKEFNGYIASFGASMIQSGLLPAIAFYEDDNS
KSQKERHKLMKVILRLISEGDECSRLLEYVIDNQDSKDSIKRRVKDGAIAVKLAIRTFKL
IDSGDKNDEGE
Download sequence
Identical sequences WP_051412066.1.56524

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]