SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_057760421.1.89827 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_057760421.1.89827
Domain Number 1 Region: 27-240
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.88e-51
Family Voltage-gated potassium channels 0.00014
Further Details:      
 
Weak hits

Sequence:  WP_057760421.1.89827
Domain Number - Region: 241-273
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00314
Family Retrovirus zinc finger-like domains 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_057760421.1.89827
Sequence length 276
Comment MULTISPECIES: ion transporter [Psychrobacter]; AA=GCF_001854065.1; RF=na; TAX=1720344; STAX=1720344; NAME=Psychrobacter sp. AntiMn-1; strain=AntiMn-1; AL=Complete Genome; RT=Major
Sequence
MKQPTAEALTHLRNRTHIIIEGTDTRLGKLFDIVLLIAILASVAVVMLDSVLYMRLQYGT
LFFYAEWFFTILFTIEYALRLFSAPNRLRYAFSFFGIVDLLSVLPSYLSLMFVGVQYLLV
IRVLRILRVFRVLKLKAYMQQAGFLASALKTSQQKITVFFLSLVLLVTIFGSIIYVVEGP
ENGFTSIPLSIYWAVVTMTTVGYGDMSPKTPLGQAIATMVMITGYSIIAVPTGIFTSELA
RNMRPQLNPVTCPNCGKFGHAVGADFCDRCGHALHI
Download sequence
Identical sequences A0A0Q9ZVV2 A0A1D9CWP5 A0A1E5KP94 A0A2I0E4J7 A0A2I0GGA9 A0A2I0GKH5 A0A2I0GVZ9 X0QA55 X0QIQ4
WP_057760421.1.34511 WP_057760421.1.89827

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]