SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_075209947.1.27095 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_075209947.1.27095
Domain Number 1 Region: 24-52
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000012
Family Retrovirus zinc finger-like domains 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_075209947.1.27095
Sequence length 66
Comment hypothetical protein [Klebsiella oxytoca]; AA=GCF_001057405.1; RF=na; TAX=571; STAX=571; NAME=Klebsiella oxytoca; strain=582_KOXY; AL=Scaffold; RT=Major
Sequence
MGYTRCTYCGSQLHTYANCPKTWGGSSRRANLRCSYCGQSGHNSNACPRNASSGRRRSLN
DDFHLD
Download sequence
Identical sequences WP_075209947.1.12591 WP_075209947.1.27095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]