SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_075937419.1.100360 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_075937419.1.100360
Domain Number 1 Region: 2-49
Classification Level Classification E-value
Superfamily Ribosomal protein L39e 2.88e-17
Family Ribosomal protein L39e 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_075937419.1.100360
Sequence length 50
Comment 50S ribosomal protein L39e [Natronomonas sp. CBA1134]; AA=GCF_001950595.1; RF=na; TAX=1906246; STAX=1906246; NAME=Natronomonas sp. CBA1134; strain=CBA1134; AL=Contig; RT=Major
Sequence
MGKKSKAQKKRLGKLERQNSRVPAWVIMKTDQDTVRNPKRRNWRRNDTDE
Download sequence
Identical sequences WP_075937419.1.100360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]