SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_077251242.1.21587 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_077251242.1.21587
Domain Number 1 Region: 17-157
Classification Level Classification E-value
Superfamily Colicin E3 receptor domain 8.76e-55
Family Colicin E3 receptor domain 0.00039
Further Details:      
 
Domain Number 2 Region: 160-254
Classification Level Classification E-value
Superfamily Ribonuclease domain of colicin E3 2.22e-37
Family Ribonuclease domain of colicin E3 0.00000315
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_077251242.1.21587
Sequence length 254
Comment cytotoxic family protein [Klebsiella pneumoniae]; AA=GCF_000417065.1; RF=na; TAX=1284800; STAX=573; NAME=Klebsiella pneumoniae UHKPC61; strain=UHKPC61; AL=Contig; RT=Major
Sequence
MEEEKRRQQAWDAAHPEEGLKREYDKAKAELDAEDKNIATLNSRIASTEKAIPGARAAVQ
EADKKVKEAEANKDDFVTYNPPHEYGSGWQDQVRYLDKDIQNQNEKLKAAQTSLNEMNES
LSRDKAALSGAMESRKQKEKKAKDAENKLNEEKKKPRKGTKDYGHDYFPDPKTEDIKGLG
ELKEGKPKTPKQGGGGKRARWYGDKKRKIYEWDSQHGELEGYRASDGEHLGAFDPKTGKQ
VKGPDPKRNIKKYL
Download sequence
Identical sequences WP_077251242.1.18150 WP_077251242.1.2045 WP_077251242.1.21587 WP_077251242.1.2432 WP_077251242.1.24566 WP_077251242.1.24951 WP_077251242.1.3716 WP_077251242.1.43492 WP_077251242.1.51670 WP_077251242.1.53588 WP_077251242.1.57618 WP_077251242.1.62733 WP_077251242.1.68940 WP_077251242.1.69637 WP_077251242.1.79175 WP_077251242.1.85805 WP_077251242.1.89340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]