SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_080625040.1.29502 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_080625040.1.29502
Domain Number 1 Region: 24-51
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000733
Family Retrovirus zinc finger-like domains 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_080625040.1.29502
Sequence length 66
Comment hypothetical protein [Citrobacter braakii]; AA=GCF_002073755.1; RF=na; TAX=57706; STAX=57706; NAME=Citrobacter braakii; strain=FDAARGOS_253; AL=Complete Genome; RT=Major
Sequence
MSYTYCTYCGSRLHTYANCPKTWGGSSRRANLRCSYCGQSGHNSNACPHNASSACRCNLN
DDFHLD
Download sequence
Identical sequences WP_080625040.1.29502 WP_080625040.1.46951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]