SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_092118673.1.6121 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_092118673.1.6121
Domain Number 1 Region: 576-1026
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 3.45e-32
Family alpha-mannosidase, C-terminal domain 0.03
Further Details:      
 
Domain Number 2 Region: 177-392
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 5.34e-26
Family alpha-mannosidase 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_092118673.1.6121
Sequence length 1028
Comment hypothetical protein [Porphyromonadaceae bacterium KH3CP3RA]; AA=GCF_900114365.1; RF=na; TAX=1855396; STAX=1855396; NAME=Porphyromonadaceae bacterium KH3CP3RA; strain=KH3CP3RA; AL=Scaffold; RT=Major
Sequence
MRKTDMAKIVFSFIVFFSTIHISSQNFTAWKIGEKDQSATEFKLAPFDYSKYNKEFGDRP
VLLETGNSNNSELTPSGPAKLENTIGEINILKGSTEPALVYGKNNEIRQYVTIEIANGGK
PQRVNLHVDDIPYEQLKLDSGINIIETSIPETMEKRDVKLSIASGREILAECIVKSYPVK
HWTVYMVQHSHTDIGFTKPQTEVLADHIRYIDYVIEYCERTENEPDELKFKWLCEATWPV
IEYLNSRPKEQVDKFIKYIRKGQIEVAGMFFNMSELVDENSFKTFLEPIRQLRKLDIPVK
TAMQNDVNGIAWCLADYMPDLGIHYFSMGQNSHRALLPFDCPTVFKWESPSGKSSYFYRF
DHYRTGNRWGISDKNIQNMAPLVFTYLNNLAEKGYPFDAVSVQYSGYHFNNSPPSLIPNA
VIKEWNEKFASPKLQSSLFHEFMDYIVNKYDSEFPVFRAAYPDWWTDGFGSAARETATSR
RTHADMIAVQGLLSIARTKGQPLPQDVHEKIRHAHTNLLFYDEHTFGAAESISDPMSESS
QVQWAQKSSYAWEALKNAQGMYEAAGGLIPVNVPGEKIPTVTFYNTLNWSRSGIVELFLN
NEIIPQNHSFKLVDDVGNELNSQLLYTKRDGVYYAVYAENIPPMGYKTYRIIVESGNAPS
PSIPPFVDNIIENDYYKIVVDTANGSIKSLFDKDLDVEMIDSESPWLLGAFVYETLNNNR
RQLEQYTLTEYTRESLDNMRLKPGHNGSLFKSFFIEGDSEGVEKRTGVKIEVRLFHNEKR
IELIYTTRKSPNTEPDGIYVSFPFKLDDAKIYFEVQGGIVSSGENQIEGTASDWNTVQNF
VSVRNNNSQFILGSNEIPLFQLGGIRTGQFQRKKSFDKPHVYSWVMNNYWTTNFRAYQEG
EFRWSYYLTSTDDTSNIAATRFGWASRVPLYARVMPAGKKNSQPAEYSAFEMDGKNLLMT
SCTPSKEEHFLLLNIREMNGESTELVIKDGDGNPYRFQIVNAIEEPLSDVVTSHSFAPFE
NKFIKIKL
Download sequence
Identical sequences WP_092118673.1.6121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]