SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001237786.1.40869 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001237786.1.40869
Domain Number 1 Region: 23-82
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000000000131
Family ATI-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_001237786.1.40869
Sequence length 85
Comment AGAP006253-PA [Anopheles gambiae str. PEST]; AA=GCF_000005575.2; RF=representative genome; TAX=180454; STAX=7165; NAME=Anopheles gambiae str. PEST; strain=PEST; AL=Chromosome; RT=Major
Sequence
MRAIFVLLVVAVFAFLGVSAQQPKKCGENEIYQRCGTGCERTCDNGDTWDKPCKAACVDK
CFCKDGFLRNENGKCVRAWHCNPNL
Download sequence
Identical sequences A0A182X8M7 Q2EQ00
XP_001237786.1.40869 AGAP006253-PA AGAP006253-PA|hypothetical 7165.AGAP006253-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]