SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001269288.1.35617 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001269288.1.35617
Domain Number 1 Region: 179-247
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.0000124
Family VPS37 C-terminal domain-like 0.027
Further Details:      
 
Weak hits

Sequence:  XP_001269288.1.35617
Domain Number - Region: 106-156
Classification Level Classification E-value
Superfamily Mediator hinge subcomplex-like 0.0759
Family CSE2-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_001269288.1.35617
Sequence length 255
Comment conserved hypothetical protein [Aspergillus clavatus NRRL 1]; AA=GCF_000002715.2; RF=representative genome; TAX=344612; STAX=5057; NAME=Aspergillus clavatus NRRL 1; strain=NRRL 1; AL=Scaffold; RT=Major
Sequence
MNPALNSDTPPPPPPKPSSHETSRGGTPQINQSLPGTPQQQFRGSYHAPDGRNEGSRFQA
LSVTEAGGISTLNNVPPAPTVEEGWLPDVVKDKSTVDLQLILKDPNLISALASQHPSCKA
QQQNLQSLLKYNQDLTNHLLELQNRLEKERASTETLLLKHQSLEVSWRKKQSEMDAALAP
WSPKALYQRLSASISEQEAVCQAVEESFLEEEHHGRATEKEAADWIRRVRAEAAKLAARR
EAKARWDEGRVGGWR
Download sequence
Identical sequences A1CQE1
ACLA_025790 XP_001269288.1.35617 5057.CADACLAP00001723

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]