SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001273941.1.35617 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001273941.1.35617
Domain Number 1 Region: 7-54
Classification Level Classification E-value
Superfamily Ribosomal protein L39e 3.01e-20
Family Ribosomal protein L39e 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_001273941.1.35617
Sequence length 55
Comment 60S ribosomal protein L39 [Aspergillus clavatus NRRL 1]; AA=GCF_000002715.2; RF=representative genome; TAX=344612; STAX=5057; NAME=Aspergillus clavatus NRRL 1; strain=NRRL 1; AL=Scaffold; RT=Major
Sequence
MTKGNKSHKSFRTKQKLAKAQRQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI
Download sequence
Identical sequences A1C9U7
5057.CADACLAP00001092 XP_001273941.1.35617 ACLA_009380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]