SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001379504.1.35504 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001379504.1.35504
Domain Number 1 Region: 28-104
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000581
Family Growth factor receptor domain 0.0033
Further Details:      
 
Domain Number 2 Region: 98-164
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000251
Family Fibronectin type I module 0.089
Further Details:      
 
Domain Number 3 Region: 188-233
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000667
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_001379504.1.35504
Sequence length 235
Comment PREDICTED: WNT1-inducible-signaling pathway protein 2 isoform X1 [Monodelphis domestica]; AA=GCF_000002295.2; RF=representative genome; TAX=13616; STAX=13616; NAME=Monodelphis domestica; AL=Chromosome; RT=Major
Sequence
MRTPQERPLLALSLLCLLFEVCAQLCRMPCTCPRIPPRCPPGAPLVLDGCGCCRVCARRL
GEPCDQLNICDQSQGLVCNYSASLGNRRGTCNFPEDDGSCEVNGRTYRDGETFQPSCKFQ
CHCSDGGFTCIPLCSEDVRLPSWDCPYPQRVDVPGKCCQEWVCDQGFQPLPATVPRFLGP
PVPLSTQFVCQEWSTLWGPCSATCGLGVATRVSNQNPHCRLEIQHRLCLLRACPP
Download sequence
Identical sequences F7FY31
ENSMODP00000020253 XP_001379504.1.35504 ENSMODP00000020253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]