SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001622080.1.94760 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001622080.1.94760
Domain Number 1 Region: 19-65
Classification Level Classification E-value
Superfamily Kringle-like 5.14e-17
Family Fibronectin type II module 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_001622080.1.94760
Sequence length 65
Comment hypothetical protein NEMVEDRAFT_v1g142575, partial [Nematostella vectensis]; AA=GCF_000209225.1; RF=representative genome; TAX=45351; STAX=45351; NAME=Nematostella vectensis; strain=CH2 x CH6; AL=Scaffold; RT=Major
Sequence
MIRVLVCPPGHLEVHAGNSPPGSCCKFPFVYKGITMHRCTREEKNFRWCATTQDYDKDKK
WGFCP
Download sequence
Identical sequences A7T236
jgi|Nemve1|142575|e_gw.686.3.1 XP_001622080.1.94760 45351.JGI142575

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]