SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001623144.1.94760 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001623144.1.94760
Domain Number 1 Region: 61-121
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000114
Family TSP-1 type 1 repeat 0.00043
Further Details:      
 
Domain Number 2 Region: 298-358
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000706
Family TSP-1 type 1 repeat 0.00024
Further Details:      
 
Domain Number 3 Region: 6-62
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000144
Family TSP-1 type 1 repeat 0.00058
Further Details:      
 
Domain Number 4 Region: 181-240
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000235
Family TSP-1 type 1 repeat 0.0005
Further Details:      
 
Domain Number 5 Region: 120-181
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000209
Family TSP-1 type 1 repeat 0.00052
Further Details:      
 
Domain Number 6 Region: 239-299
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000111
Family TSP-1 type 1 repeat 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_001623144.1.94760
Sequence length 360
Comment predicted protein, partial [Nematostella vectensis]; AA=GCF_000209225.1; RF=representative genome; TAX=45351; STAX=45351; NAME=Nematostella vectensis; strain=CH2 x CH6; AL=Scaffold; RT=Major
Sequence
MQLGVLVDGGFAEWSDFTSCSVTCAQGSRTRRRLCTSPPPQHGGLNCTGAFSETTPCNLR
PCPINGNYTQWSEYTPCSKTCGGGTRHRTRSCTNPAPQYGGVNCTVIGNPVDTIECNTSP
CPVDGGYTSWTEFSPCSVTCGRGLSTRSRACSEPAPQYGGRNCSEFLGPNTEEVPCFPKL
CPIDGFYGNWSAFTRCSLSCGGGTQSRNRSCDSPSPVGEGLNCTRLGPALEIRVCNTQPC
PIHGGFSEWTDFGNCTRECDGGVHYRTRSCTNPVPFAGGEGCSLLGPARESRQCNTNPCP
VNGAYGPWAPFSPCSATCGGGRMVRRRYCDNPSPQHGGKNCSSLGRPVESSSCNTNKCPG
Download sequence
Identical sequences A7SZ33
jgi|Nemve1|138675|e_gw.439.15.1 XP_001623144.1.94760 45351.JGI138675

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]