SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001682883.1.98313 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001682883.1.98313
Domain Number 1 Region: 6-128
Classification Level Classification E-value
Superfamily Smp-1-like 3.14e-49
Family Smp-1-like 0.000000221
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_001682883.1.98313
Sequence length 131
Comment putative calpain-like cysteine peptidase [Leishmania major strain Friedlin]; AA=GCF_000002725.2; RF=representative genome; TAX=347515; STAX=5664; NAME=Leishmania major strain Friedlin; strain=Friedlin; AL=Complete Genome; RT=Major
Sequence
MGCGASSENSSVTYVNGRPTFVGEEVTKGFEKDNGLLFRIVNKKKKQWAYYNDTTQYEMH
VLVTFNEDCDIKALGKTKLEQQENGEWVASVVVYPCETEMFIEGRVNGFKSKMDALPLSE
EYRQHQAEKDK
Download sequence
Identical sequences Q5SDH5
000001373|e2fe0A1|10.15.1.1|A:6-136 gi|157868661|ref|XP_001682883.1| gi|68126339|emb|CAJ04271.1| psu|LmjF20.1310 XP_001682883.1.98313

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]